Restaurants Explorer
HomeDining DiscoveriesBest Restaurants Near Me
Arizona

Restaurants ExplorerBest Restaurants Near MeArizonaMaricopa CountyGlendaleBest Restaurants in West Northern AvenueÉpale! Nutrition Herbalife
Épale! Nutrition Herbalife ico

Épale! Nutrition Herbalife
- 5102 W Northern Ave #2, Glendale, AZ 85301

Restaurant, Juice shop ★4.0 (46)·$10–20

5102 W Northern Ave #2, Glendale, AZ 85301, USA

4.0
Drinks actually taste good , you can add healthy options to your orders, isn't overpriced, nice music to vibe to and the atmosphere is very relaxed. First timer but will definitely keep going here. - Efdee Pro
Épale! Nutrition Herbalife Overview Intro Food & drink Detail Photos Location Reviews
$10–20 per person Reported by 46 people$1–10$10–20$20–30

Épale! Nutrition Herbalife Introduce

For residents across the Valley who prioritize health, convenience, and flavor, **Épale! Nutrition Herbalife** offers a refreshing alternative to traditional fast food and coffee shops. Located in Glendale, this unique establishment operates as a specialized juice shop and quick-service restaurant, focusing on nutrient-dense, protein-packed, and often low-sugar options. In a region where a quick, energizing bite is essential, Épale! provides a welcoming and happy atmosphere that caters directly to the healthy, active Arizona lifestyle.

The concept behind Épale! Nutrition is rooted in the popular Herbalife Nutrition Club model, which emphasizes community support, personal wellness coaching, and the consumption of high-quality nutritional products. However, for the customer, the experience feels like a modern, friendly juice bar and cafe. Patrons rave that the products, including the wide array of protein shakes and teas, actually taste good while maintaining their healthy profile—a key differentiator from many high-sugar drinks found elsewhere. The staff are known for their personalized service, often remembering customers by name, which contributes to the relaxed, casual, and trendy atmosphere perfect for a solo dining experience or a quick chat.

The extensive menu is a wonderland for anyone seeking to replace a meal with a balanced shake or grab a guilt-free quick bite. From decadent-sounding protein shakes (like Strawberry Cheesecake and Cookies&Cream) to energizing Protein Coffees and simple healthy snacks, Épale! has positioned itself as the go-to destination for fuel before or after a workout, a healthy breakfast on the go, or a satisfying lunch that supports your wellness goals.

Location and Accessibility

Épale! Nutrition Herbalife is conveniently situated in a high-traffic area of Glendale, making it easily accessible for commuters and local residents throughout the West Valley. Its location offers crucial benefits for Arizona locals who value speed and ease of access.

The address is: 5102 W Northern Ave #2, Glendale, AZ 85301, USA.

Positioned directly on W Northern Ave, a main thoroughfare, the location is simple to find. Accessibility features are a major highlight, ensuring that the establishment can serve all members of the community without hindrance:

  • Wheelchair Accessible Entrance and Seating: Ensuring the physical space is welcoming for everyone.
  • Wheelchair Accessible Parking Lot: Convenient parking directly adjacent to the entrance.
  • Wheelchair Accessible Restroom: Prioritizing comfort and accessibility for all patrons.
  • Ample Parking: Customers can utilize the free parking lot and free street parking surrounding the location.

Services Offered

Understanding the busy, on-the-go nature of life in Arizona, Épale! offers a variety of quick and efficient service options designed to fit seamlessly into any schedule.

  • Drive-Through: An essential service for fast, convenient pickup without needing to park, ideal for morning commutes.
  • Curbside Pickup: Allowing customers to call ahead and have their order delivered directly to their vehicle.
  • Takeout: Quick and efficient service for orders placed in person.
  • Dine-in: A casual, quiet, and trendy atmosphere for enjoying a meal, perfect for solo dining or small groups.
  • Dining Options: Serving both breakfast and lunch, as well as dessert-style protein options throughout the day.
  • Mobile Payments: Accepting Credit Cards, Debit Cards, and modern NFC mobile payments for swift, contact-free transactions.

Features / Highlights

The primary strength of Épale! lies in its expansive menu focused on health and a welcoming, service-oriented culture.

  • Protein Shake Variety: An overwhelming selection of over 40 distinct and creative protein shake flavors, including unique options like Duvalin Fresa, Arroz Con Leche, Mazapán, and a variety of Cheesecake flavors, ensuring a shake never gets boring.
  • Great Tea and Hydration Selection: Recognized for its "Great tea selection," which includes energy-boosting, low-sugar beverages perfect for Arizona's heat, such as Strawberry Blue Raspberry, Peach Mango, and various “Margarita” flavors.
  • Diverse Dietary Offerings: A strong commitment to inclusive nutrition, featuring extensive healthy options, along with clear **Vegan options** and **Vegetarian options** to cater to various dietary preferences. The inclusion of a simple 'Vanilla' flavor under Vegetarian specifically offers a foundational healthy choice.
  • Specialty Protein Products: Going beyond drinks, the menu includes quick, protein-rich snacks and meal replacements like **Protein Waffles**, **Mini Protein Donuts**, and **Protein Coffee** (including House Blend and flavors like Caramel Macchiato and Mocha) for a nutritious caffeine boost.
  • Focus on Breakfast and Lunch: Popular for both major dining times, providing a reliable source of healthy, quick-service food that is highly sought after by the Arizona community for meal replacement and sustained energy.
  • Friendly and Relaxed Atmosphere: Customers frequently highlight the happy, relaxed, and personalized environment where staff remember them by name, transforming a quick stop into a genuine community experience.

Contact Information

For placing orders ahead of time, checking daily specials, or inquiring about the extensive menu options, customers are encouraged to use the direct phone line. The accessibility and numerous takeout options make advance ordering a smart choice, especially during peak meal times in the Glendale area.

Address: 5102 W Northern Ave #2, Glendale, AZ 85301, USA
Phone: (602) 410-7555
Mobile Phone: +1 602-410-7555

What is Worth Choosing Épale! Nutrition Herbalife

Épale! Nutrition Herbalife is worth choosing for any Arizona user looking for a powerful combination of health, taste, and maximum convenience. This is not your average juice bar—it's a destination for high-protein, nutritionally-balanced, and delicious meal replacements and energizing beverages. You should choose Épale! because they master the art of masking healthy ingredients with exciting flavors, meaning you can enjoy a 'Snickers' or 'Chocolate Carmel Cheesecake' shake without derailing your diet. The unparalleled commitment to service, evident in both the friendly, personalized atmosphere and the practicality of offering a **drive-through**, **curbside pickup**, and a fully **wheelchair accessible** facility, makes it an ideal, stress-free stop for the fast-paced, health-conscious life in the Phoenix metro area. It serves as a vital resource for quick, nutritious fuel, supporting both fitness goals and busy schedules. When you need a healthy choice for breakfast or lunch that is fast, fun, and doesn't compromise on flavor, Épale! is the premier option in Glendale.

Épale! Nutrition Herbalife Food & drink

  • Coffee Flavors

  • Coffee Lover's
  • Caramel Macchiato
  • Mocha
  • Café Latte
  • Vegetarian

  • Vanilla
  • Protein Specialties

  • Protein Waffles
  • Mini Protein Donuts
  • Protein Coffee

  • House Blend
  • Fit Menu

  • Hydrate $2.00
  • Gym Drink
  • Enhanced Protein $6.00
  • Protein Snacks

  • Citrus Lemon Bar
  • Almond Vanilla
  • Banana Flavors

  • Peanut Butter
  • Banana
  • Banana Strawberry
  • Banana Chocolate
  • Chocolate Flavors

  • Chocolate Mint
  • Snickers
  • Chocolate Peanut Butter
  • Protein Shakes

  • Banana Nuts
  • Almond Delight
  • Chocolate Lover's
  • Others

  • Almond Delight
  • Oatmeal Cookie
  • Strawberry Cheesecake
  • Vanilla Cupcake
  • Duvalin Fresa
  • Arroz Con Leche
  • Cookies&Cream
  • Pralines&Cream
  • Cinnabon
  • Mazapán
  • Banana Nuts Bread
  • Banana Strawberry
  • Banana Chocolate
  • Banana Chocolate And Peanut Butter
  • Strawberry Berry
  • Tropical Sunrise
  • Mango Pineapple
  • Piña Colada Delight
  • Orange&Cream
  • Chocolate Lover's
  • Almond Joy
  • Peanut Butter Oreo
  • Chocolate Pralines
  • Chocolate Mint
  • Snickers
  • Chocolate Peanut Butter
  • Açai Bery Tropical Coconut
  • Mexican Lollipop
  • Lemonade Margarita
  • Strawberry Blue Raspberry
  • Peach Mango
  • Apple Margarita
  • Grape Blackberry
  • Acai Berry
  • Cucumber Watermelon
  • Watermelon Chamoy
  • Dragon Pomegranate
  • Chocolate Carmel Cheesecake
  • Cheesecake
  • Tropical Fruit

Épale! Nutrition Herbalife Details

  • Service options

  • Curbside pickup
  • Drive-through
  • Takeout
  • Dine-in
  • Delivery
  • Highlights

  • Great tea selection
  • Popular for

  • Breakfast
  • Lunch
  • Solo dining
  • Accessibility

  • Wheelchair accessible entrance
  • Wheelchair accessible parking lot
  • Wheelchair accessible restroom
  • Wheelchair accessible seating
  • Offerings

  • Coffee
  • Healthy options
  • Quick bite
  • Vegan options
  • Vegetarian options
  • Dining options

  • Breakfast
  • Lunch
  • Dessert
  • Amenities

  • Restroom
  • Atmosphere

  • Casual
  • Quiet
  • Trendy
  • Payments

  • Credit cards
  • Debit cards
  • NFC mobile payments
  • Children

  • Good for kids
  • Parking

  • Free parking lot
  • Free street parking
  • Parking

Épale! Nutrition Herbalife Photos

Épale! Nutrition Herbalife Picture 1Épale! Nutrition Herbalife Picture 2Épale! Nutrition Herbalife Picture 3Épale! Nutrition Herbalife Picture 4Épale! Nutrition Herbalife Picture 5Épale! Nutrition Herbalife Picture 6Épale! Nutrition Herbalife Picture 7Épale! Nutrition Herbalife Picture 8Épale! Nutrition Herbalife Picture 9Épale! Nutrition Herbalife Picture 10

Épale! Nutrition Herbalife Location

Épale! Nutrition Herbalife

5102 W Northern Ave #2, Glendale, AZ 85301, USA

Épale! Nutrition Herbalife Reviews

An average rating of ★4.9 from 86 user reviews.

proteinshakeswafflehealthyenergyenvironmentowneracaismoothielicuado

★ 5★ 4★ 3★ 2★ 1

More Best Restaurants Near Me

  • Bunzee Burgers & WingsBunzee Burgers & Wings4.0 (265 reviews)

    8024 N 51st Ave, Glendale, AZ 85302, USA

  • Taco Mich & BarTaco Mich & Bar3.0 (992 reviews)

    5122 W Northern Ave, Glendale, AZ 85301, USA

  • Bodega Mikeu2019sBodega Mikeu2019s0.0 (0 reviews)

    5056 W Northern Ave, Glendale, AZ 85301, USA

  • Mikes Cuban SandwichesMikes Cuban Sandwiches0.0 (0 reviews)

    5065 W Northern Ave, Glendale, AZ 85301, USA

  • Pupusas Dona Mary 3Pupusas Dona Mary 33.0 (246 reviews)

    5160 W Northern Ave, Glendale, AZ 85301, USA

  • Lalos TacosLalos Tacos4.0 (66 reviews)

    7980 N 51st Ave, Glendale, AZ 85301, USA

  • Siam Thai CuisineSiam Thai Cuisine4.0 (870 reviews)

    5008 W Northern Ave, Glendale, AZ 85301, USA

  • Weenie Mama HotdogsWeenie Mama Hotdogs5.0 (20 reviews)

    4949 W Northern Ave, Glendale, AZ 85301, USA

  • Luna PizzaLuna Pizza4.0 (685 reviews)

    7800 N 55th Ave #108, Glendale, AZ 85301, USA

  • Sonora Taco Shop 2Sonora Taco Shop 24.0 (82 reviews)

    7800 N 55th Ave #110, Glendale, AZ 85301, USA

  • Ritou2019s Burritos- GlendaleRitou2019s Burritos- Glendale4.0 (733 reviews)

    7416 N 51st Ave, Glendale, AZ 85301, USA

  • SUSHI ANTOJITOS el kikeSUSHI ANTOJITOS el kike4.0 (80 reviews)

    7420 N 51st Ave, Glendale, AZ 85301, USA

  • Categories

    Top Visited Sites

    Trending Dining Discoveries Posts