Épale! Nutrition Herbalife Introduce
For residents across the Valley who prioritize health, convenience, and flavor, **Épale! Nutrition Herbalife** offers a refreshing alternative to traditional fast food and coffee shops. Located in Glendale, this unique establishment operates as a specialized juice shop and quick-service restaurant, focusing on nutrient-dense, protein-packed, and often low-sugar options. In a region where a quick, energizing bite is essential, Épale! provides a welcoming and happy atmosphere that caters directly to the healthy, active Arizona lifestyle.
The concept behind Épale! Nutrition is rooted in the popular Herbalife Nutrition Club model, which emphasizes community support, personal wellness coaching, and the consumption of high-quality nutritional products. However, for the customer, the experience feels like a modern, friendly juice bar and cafe. Patrons rave that the products, including the wide array of protein shakes and teas, actually taste good while maintaining their healthy profile—a key differentiator from many high-sugar drinks found elsewhere. The staff are known for their personalized service, often remembering customers by name, which contributes to the relaxed, casual, and trendy atmosphere perfect for a solo dining experience or a quick chat.
The extensive menu is a wonderland for anyone seeking to replace a meal with a balanced shake or grab a guilt-free quick bite. From decadent-sounding protein shakes (like Strawberry Cheesecake and Cookies&Cream) to energizing Protein Coffees and simple healthy snacks, Épale! has positioned itself as the go-to destination for fuel before or after a workout, a healthy breakfast on the go, or a satisfying lunch that supports your wellness goals.
Location and Accessibility
Épale! Nutrition Herbalife is conveniently situated in a high-traffic area of Glendale, making it easily accessible for commuters and local residents throughout the West Valley. Its location offers crucial benefits for Arizona locals who value speed and ease of access.
The address is: 5102 W Northern Ave #2, Glendale, AZ 85301, USA.
Positioned directly on W Northern Ave, a main thoroughfare, the location is simple to find. Accessibility features are a major highlight, ensuring that the establishment can serve all members of the community without hindrance:
- Wheelchair Accessible Entrance and Seating: Ensuring the physical space is welcoming for everyone.
- Wheelchair Accessible Parking Lot: Convenient parking directly adjacent to the entrance.
- Wheelchair Accessible Restroom: Prioritizing comfort and accessibility for all patrons.
- Ample Parking: Customers can utilize the free parking lot and free street parking surrounding the location.
Services Offered
Understanding the busy, on-the-go nature of life in Arizona, Épale! offers a variety of quick and efficient service options designed to fit seamlessly into any schedule.
- Drive-Through: An essential service for fast, convenient pickup without needing to park, ideal for morning commutes.
- Curbside Pickup: Allowing customers to call ahead and have their order delivered directly to their vehicle.
- Takeout: Quick and efficient service for orders placed in person.
- Dine-in: A casual, quiet, and trendy atmosphere for enjoying a meal, perfect for solo dining or small groups.
- Dining Options: Serving both breakfast and lunch, as well as dessert-style protein options throughout the day.
- Mobile Payments: Accepting Credit Cards, Debit Cards, and modern NFC mobile payments for swift, contact-free transactions.
Features / Highlights
The primary strength of Épale! lies in its expansive menu focused on health and a welcoming, service-oriented culture.
- Protein Shake Variety: An overwhelming selection of over 40 distinct and creative protein shake flavors, including unique options like Duvalin Fresa, Arroz Con Leche, Mazapán, and a variety of Cheesecake flavors, ensuring a shake never gets boring.
- Great Tea and Hydration Selection: Recognized for its "Great tea selection," which includes energy-boosting, low-sugar beverages perfect for Arizona's heat, such as Strawberry Blue Raspberry, Peach Mango, and various “Margarita” flavors.
- Diverse Dietary Offerings: A strong commitment to inclusive nutrition, featuring extensive healthy options, along with clear **Vegan options** and **Vegetarian options** to cater to various dietary preferences. The inclusion of a simple 'Vanilla' flavor under Vegetarian specifically offers a foundational healthy choice.
- Specialty Protein Products: Going beyond drinks, the menu includes quick, protein-rich snacks and meal replacements like **Protein Waffles**, **Mini Protein Donuts**, and **Protein Coffee** (including House Blend and flavors like Caramel Macchiato and Mocha) for a nutritious caffeine boost.
- Focus on Breakfast and Lunch: Popular for both major dining times, providing a reliable source of healthy, quick-service food that is highly sought after by the Arizona community for meal replacement and sustained energy.
- Friendly and Relaxed Atmosphere: Customers frequently highlight the happy, relaxed, and personalized environment where staff remember them by name, transforming a quick stop into a genuine community experience.
Contact Information
For placing orders ahead of time, checking daily specials, or inquiring about the extensive menu options, customers are encouraged to use the direct phone line. The accessibility and numerous takeout options make advance ordering a smart choice, especially during peak meal times in the Glendale area.
Address: 5102 W Northern Ave #2, Glendale, AZ 85301, USA
Phone: (602) 410-7555
Mobile Phone: +1 602-410-7555
What is Worth Choosing Épale! Nutrition Herbalife
Épale! Nutrition Herbalife is worth choosing for any Arizona user looking for a powerful combination of health, taste, and maximum convenience. This is not your average juice bar—it's a destination for high-protein, nutritionally-balanced, and delicious meal replacements and energizing beverages. You should choose Épale! because they master the art of masking healthy ingredients with exciting flavors, meaning you can enjoy a 'Snickers' or 'Chocolate Carmel Cheesecake' shake without derailing your diet. The unparalleled commitment to service, evident in both the friendly, personalized atmosphere and the practicality of offering a **drive-through**, **curbside pickup**, and a fully **wheelchair accessible** facility, makes it an ideal, stress-free stop for the fast-paced, health-conscious life in the Phoenix metro area. It serves as a vital resource for quick, nutritious fuel, supporting both fitness goals and busy schedules. When you need a healthy choice for breakfast or lunch that is fast, fun, and doesn't compromise on flavor, Épale! is the premier option in Glendale.
Épale! Nutrition Herbalife Food & drink
Coffee Flavors
- Coffee Lover's
- Caramel Macchiato
- Mocha
- Café Latte
Vegetarian
- Vanilla
Protein Specialties
- Protein Waffles
- Mini Protein Donuts
Protein Coffee
- House Blend
Fit Menu
- Hydrate $2.00
- Gym Drink
- Enhanced Protein $6.00
Protein Snacks
- Citrus Lemon Bar
- Almond Vanilla
Banana Flavors
- Peanut Butter
- Banana
- Banana Strawberry
- Banana Chocolate
Chocolate Flavors
- Chocolate Mint
- Snickers
- Chocolate Peanut Butter
Protein Shakes
- Banana Nuts
- Almond Delight
- Chocolate Lover's
Others
- Almond Delight
- Oatmeal Cookie
- Strawberry Cheesecake
- Vanilla Cupcake
- Duvalin Fresa
- Arroz Con Leche
- Cookies&Cream
- Pralines&Cream
- Cinnabon
- Mazapán
- Banana Nuts Bread
- Banana Strawberry
- Banana Chocolate
- Banana Chocolate And Peanut Butter
- Strawberry Berry
- Tropical Sunrise
- Mango Pineapple
- Piña Colada Delight
- Orange&Cream
- Chocolate Lover's
- Almond Joy
- Peanut Butter Oreo
- Chocolate Pralines
- Chocolate Mint
- Snickers
- Chocolate Peanut Butter
- Açai Bery Tropical Coconut
- Mexican Lollipop
- Lemonade Margarita
- Strawberry Blue Raspberry
- Peach Mango
- Apple Margarita
- Grape Blackberry
- Acai Berry
- Cucumber Watermelon
- Watermelon Chamoy
- Dragon Pomegranate
- Chocolate Carmel Cheesecake
- Cheesecake
- Tropical Fruit
Épale! Nutrition Herbalife Details
Service options
- Curbside pickup
- Drive-through
- Takeout
- Dine-in
- Delivery
Highlights
- Great tea selection
Popular for
- Breakfast
- Lunch
- Solo dining
Accessibility
- Wheelchair accessible entrance
- Wheelchair accessible parking lot
- Wheelchair accessible restroom
- Wheelchair accessible seating
Offerings
- Coffee
- Healthy options
- Quick bite
- Vegan options
- Vegetarian options
Dining options
- Breakfast
- Lunch
- Dessert
Amenities
- Restroom
Atmosphere
- Casual
- Quiet
- Trendy
Payments
- Credit cards
- Debit cards
- NFC mobile payments
Children
- Good for kids
Parking
- Free parking lot
- Free street parking
- Parking
Épale! Nutrition Herbalife Photos










Épale! Nutrition Herbalife Location
Épale! Nutrition Herbalife
5102 W Northern Ave #2, Glendale, AZ 85301, USA
Épale! Nutrition Herbalife Reviews
proteinshakeswafflehealthyenergyenvironmentowneracaismoothielicuado
★ 5★ 4★ 3★ 2★ 1Drinks actually taste good , you can add healthy options to your orders, isn't overpriced, nice music to vibe to and the atmosphere is very relaxed. First timer but will definitely keep going here.
October 06 · Efdee ProI love this place! They don't add a bunch of chemicals and sugar to their drinks. They remember you by name. It is a very happy atmosphere.
August 22 · Winter ThatcherTook my two grandchildren in, and we were welcomed by a wonderful, friendly owner. The establishment was clean and very comfortable. The owner explained the nutritional ingredients and health value of the menu. I am a diabetic and really liked what I ordered. We found out place for our Acai Cup, it was delicious! I will recommend this place to my family and friends.
June 27 · Velinda ArolloDelicious! I bought a Carmel Macchiato protein shake and it was so yummy! Great taste and great service! The woman who greeted me was super friendly and I’ll be coming back here soon. If you want a high protein shake or snack this place has it all.
September 15 · Macy LynnLove this place. Smoothies are GREAT with clean ingredients, and perfect protein! Also love their children’s book area!
August 03 · Expressive Worship
More Best Restaurants Near Me
Bunzee Burgers & Wings4.0 (265 reviews)8024 N 51st Ave, Glendale, AZ 85302, USA
Taco Mich & Bar3.0 (992 reviews)5122 W Northern Ave, Glendale, AZ 85301, USA
Bodega Mikeu2019s0.0 (0 reviews)5056 W Northern Ave, Glendale, AZ 85301, USA
Mikes Cuban Sandwiches0.0 (0 reviews)5065 W Northern Ave, Glendale, AZ 85301, USA
Pupusas Dona Mary 33.0 (246 reviews)5160 W Northern Ave, Glendale, AZ 85301, USA
Lalos Tacos4.0 (66 reviews)7980 N 51st Ave, Glendale, AZ 85301, USA
Siam Thai Cuisine4.0 (870 reviews)5008 W Northern Ave, Glendale, AZ 85301, USA
Weenie Mama Hotdogs5.0 (20 reviews)4949 W Northern Ave, Glendale, AZ 85301, USA
Luna Pizza4.0 (685 reviews)7800 N 55th Ave #108, Glendale, AZ 85301, USA
Sonora Taco Shop 24.0 (82 reviews)7800 N 55th Ave #110, Glendale, AZ 85301, USA
Ritou2019s Burritos- Glendale4.0 (733 reviews)7416 N 51st Ave, Glendale, AZ 85301, USA
SUSHI ANTOJITOS el kike4.0 (80 reviews)7420 N 51st Ave, Glendale, AZ 85301, USA
Categories
Top Visited Sites
Taqueria lucy4.0 (209 reviews)
The Stand Arcadia Burger Shoppe4.0 (2115 reviews)
Mesquite Fresh Street Mex4.0 (3138 reviews)
DOS PINK4.0 (135 reviews)
Marisco Boys4.0 (114 reviews)
Big Bacon's4.0 (146 reviews)Trending Dining Discoveries Posts
Why You Should Try the Best Poke Bowls in Your City
Top 5 Best Restaurants in Austin for a Perfect Dinner Date
Where to Find the Best BBQ Ribs in Texas
The Best Street Food Markets in New York City for a Culinary Adventure
The Best Sushi Restaurants in Austin for a Fresh Dining Experience
Where to Find the Best Sushi in Seattle: Top Sushi Spots & Must-Try Dishes
